DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and KCNK7

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_203133.1 Gene:KCNK7 / 10089 HGNCID:6282 Length:307 Species:Homo sapiens


Alignment Length:316 Identity:63/316 - (19%)
Similarity:111/316 - (35%) Gaps:112/316 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 ATEAVLLHTHYHHHRAGGVGGVAVGGGPPHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTL 633
            ||:|         |....:|..:.|    ..|:...|.|::.::|||.|||::||.:..|:...:
Human    72 ATQA---------HGVSTLGNSSEG----RTWDLPSALLFAASILTTTGYGHMAPLSPGGKAFCM 123

  Fly   634 AYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQE 698
            .||..|:|.:|..:::                |..||.                           
Human   124 VYAALGLPASLALVAT----------------LRHCLL--------------------------- 145

  Fly   699 ELRKQQAVMQEP-YYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGL 762
                  .|:..| .:|...:..:|.:.|                                     
Human   146 ------PVLSRPRAWVAVHWQLSPARAA------------------------------------- 167

  Fly   763 SILAPILLCFSMMIIYIVFGAAVLYRLE-KWPILDGIYFCFMSLSTIGFGDMLPGLRRESNATTW 826
             :|..:.|...:...:::..|.||:.|: ...:|..:||||.||||||..|:|||..|..:...:
Human   168 -LLQAVALGLLVASSFVLLPALVLWGLQGDCSLLGAVYFCFSSLSTIGLEDLLPGRGRSLHPVIY 231

  Fly   827 FCSV-----YIMSGMTLTAMCFNVIHEEIVHRIRIVVEFKKTS---AANSGGGLIG 874
            ....     |::.|:....:......|  :.::|.:.:|.:.|   .|...||::|
Human   232 HLGQLALLGYLLLGLLAMLLAVETFSE--LPQVRAMGKFFRPSGPVTAEDQGGILG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 17/56 (30%)
Ion_trans <601..640 CDD:278921 13/38 (34%)
Ion_trans_2 774..846 CDD:285168 22/77 (29%)
KCNK7NP_203133.1 Ion_trans_2 <90..140 CDD:285168 17/65 (26%)
Ion_trans_2 182..>220 CDD:285168 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.