DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42594 and XB5727110

DIOPT Version :9

Sequence 1:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_031747981.1 Gene:XB5727110 / 100486031 XenbaseID:XB-GENE-5727111 Length:318 Species:Xenopus tropicalis


Alignment Length:277 Identity:63/277 - (22%)
Similarity:106/277 - (38%) Gaps:100/277 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSK 664
            |:.:.:|.::.||:||||||.::|||..|:|..:.||.|||||.::.|...|.||:||       
 Frog    90 WDMSSSFFFAGTVVTTIGYGTLSPRTPGGQIFCVLYALFGIPLNVIVLGRVGKILSRV------- 147

  Fly   665 ALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGA 729
                  |...|...:::                                              |.
 Frog   148 ------CHRLGQYFFNK----------------------------------------------GM 160

  Fly   730 PPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPI 794
            .|..|                            .:|..|....:.:|:::.....:..:.|||..
 Frog   161 KPKKA----------------------------KVLTIIFFSVTGIIVFLGLPPLLFTKTEKWTY 197

  Fly   795 LDGIYFCFMSLSTIGFGDMLPGLRRE-----SNATTWFCSVYIMSGMTLTAMCFNVI-------H 847
            .:|:|:.|:|||||||||.:.|...:     .......| ::|:.|::..::.||::       .
 Frog   198 TEGVYYAFISLSTIGFGDYVVGYGPQHFMPFRGFRALVC-LWIIFGLSWLSLLFNLLTSLLEDTE 261

  Fly   848 EEIVHRIRIVVEFKKTS 864
            ::|...|:..|:.||.|
 Frog   262 KKIAKDIQKKVKSKKDS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 26/55 (47%)
Ion_trans <601..640 CDD:278921 17/38 (45%)
Ion_trans_2 774..846 CDD:285168 22/76 (29%)
XB5727110XP_031747981.1 Ion_trans_2 86..146 CDD:400301 26/55 (47%)
Ion_trans_2 178..245 CDD:400301 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.