DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FDY and PPYR1

DIOPT Version :9

Sequence 1:NP_001303579.2 Gene:FDY / 8674077 FlyBaseID:FBgn0265047 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_573012.1 Gene:PPYR1 / 32453 FlyBaseID:FBgn0030623 Length:309 Species:Drosophila melanogaster


Alignment Length:360 Identity:90/360 - (25%)
Similarity:131/360 - (36%) Gaps:130/360 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AAVVAAPK-KPEPAKAPKVPKSKSEKE---NKPVVAGRKANTPVAKNASPVKGGKGPAGGDVGRP 88
            :::||.|| ..:|.||.::.:.|.|.:   ..|:.|.:|......|.|.|::  |......|..|
  Fly    21 SSMVAVPKMSQKPQKAARLFQPKVENKITLTTPLTAPKKERVKDIKVADPLE--KEVESVFVTVP 83

  Fly    89 KNPTANGANNQGRFNNNQRYGNKESIGEFGNELPQRQFNNRDNRGPPRVRSGEKFGKREFDRQSG 153
            ||                                 :....|.||.          |.|.|||:||
  Fly    84 KN---------------------------------KLCKTRRNRP----------GDRLFDRRSG 105

  Fly   154 SDKTGVKSIDKREGVGAHNWGSPKQDIEDLKTTGETSPQAEKKDSANEQSADPAVAA------EE 212
            |.:||||:::||.|.|||||||.:|:|:..:.|...:.:..|.         |.|::      ..
  Fly   106 SKRTGVKAVEKRNGAGAHNWGSIQQEIDLRQRTNLRTFEGMKL---------PKVSSFVYEYDSS 161

  Fly   213 DESKQMTLDEWKALRDQRAKPNYNLRKAGEGAADNAEWKKMIVLSK--------KKE--SNSEDE 267
            :|::|.|||||:|::.|:.:                      ||:|        |||  ..||:.
  Fly   162 EETEQYTLDEWRAMQAQKKQ----------------------VLNKFIMSDFGTKKEVTGGSEET 204

  Fly   268 LEYDPSLYPQRVGRLQRIVDIQFNFNDGRKGGFRKGTRRGAGPCEGGFRNDG------------P 320
            :..:.|                 ...|..||..:.|.....|..|.|.|:.|            |
  Fly   205 VRAEGS-----------------GDTDDTKGLDKTGGTEQTGNTETGERSAGSGETETAAASGVP 252

  Fly   321 RGEGGYRNDGPRGEGGYRNEG---PRGEGYRNDGP 352
            ...||  :.|..|.||....|   ..||....|.|
  Fly   253 DASGG--SGGTEGSGGLGGSGELEDDGEELTADRP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FDYNP_001303579.2 HABP4_PAI-RBP1 144..242 CDD:335891 37/103 (36%)
PRK11634 <308..368 CDD:236941 17/60 (28%)
PPYR1NP_573012.1 HABP4_PAI-RBP1 96..180 CDD:282609 37/92 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I4255
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002116
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12299
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.