DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and si:ch211-207i20.3

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 / 555734 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio


Alignment Length:257 Identity:57/257 - (22%)
Similarity:97/257 - (37%) Gaps:83/257 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLIASVKRNVSIFEKYHTRY---DRKQA-WIAVAQACQKSVEYCQIRWKSLRDRYVRETQ----- 62
            ||:..|..|..:|:|.|:.|   .||:| |..:|......||..:.:||:|||.|.|:.:     
Zfish    34 LLLFLVSENKELFDKNHSEYKNTKRKEALWQGIADKMGVDVEEVKAKWKNLRDTYTRKKRLEQDG 98

  Fly    63 ----KPAATRSNIRKFKELDFL---REHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELALE 120
                :.|..:...:..:.:|||   .||                    ..|: :||:..|:    
Zfish    99 SRSGRAAKKKKQWKYMRVMDFLDPATEH--------------------RSGI-LDSKIEDD---- 138

  Fly   121 RNGITEFQPDEFIIEYKGEEEYLSETDNSSAEFISEDSACNIGSELPYVTKPSFNGEGQSQTQAK 185
                   :|||                :|.||..|..:..::.|  |...:.|.....:|:|   
Zfish   139 -------EPDE----------------DSGAEPASTSTGTSVTS--PEAMRSSIVKRRRSET--- 175

  Fly   186 FMSVMNLIESAL-----KDKPAEPQ-----DPFYKYLESILTGVDDSTRIDIQLKVLNFVSD 237
                :.|:|..|     ||:..:.|     |.|.:.|...|..:..|.:..::|::...:.|
Zfish   176 ----LELLEKYLATKDAKDREKDEQQQDEVDLFLRSLAPALRRLPASKQSLVKLQIQKILHD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 27/92 (29%)
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 25/86 (29%)
BESS 199..233 CDD:308542 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.