DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and jigr1

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:259 Identity:57/259 - (22%)
Similarity:97/259 - (37%) Gaps:70/259 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDALLIASVKRNVSIFEKYHTRYDRK----QAWIAVAQACQKSVEYCQIRWKSLRDRY---VRET 61
            ||..||...:.:..::::.:.|:..|    ..|..:|..........:.|..:||:||   .|..
  Fly    29 FDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRV 93

  Fly    62 QKPAATRSN-IRKFKELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELALERNGIT 125
            :...:|:|: ...|:.|.||.:|||.||....:.         |.....::...|:...:.||..
  Fly    94 ENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMS---------VKEEDEETYEVDDCRSDSNGHM 149

  Fly   126 EFQPDEFIIEYKGE----EEYLSETD------NSSAEFISEDSACNIGSELPYVTKPSFNGEG-- 178
            ....||  :|...|    |:.|..|.      |:|.|  :..|..:...|:|       ||:|  
  Fly   150 NSIKDE--LEDDSEIFDCEQALPVTTVLGIPLNNSDE--ANKSQRSTNGEMP-------NGKGYN 203

  Fly   179 --------QSQTQAKFM---SVMNLIES------ALKDKPAEPQDPFYKYLESILTGVDDSTRI 225
                    :.|.|.:::   .::|.:.|      .|.|.|::.:             ||||..|
  Fly   204 HFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRR-------------VDDSLSI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 19/84 (23%)
jigr1NP_001097920.1 MADF 33..118 CDD:214738 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.