DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and Mes2

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster


Alignment Length:236 Identity:45/236 - (19%)
Similarity:83/236 - (35%) Gaps:51/236 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VKRNVS----IFEKYH---------------TRYDRKQAWIAVAQACQKSVEYCQIRWKSLRDRY 57
            |:||.|    :.:..|               ...::.:||..:.:............:||||:.|
  Fly    53 VRRNASDKLKLIQMVHDNPILWDSRLPNFKGAEEEKNRAWEHIGREFNAPGRRVARAFKSLRESY 117

  Fly    58 VRETQKPAATRSNIRK----FKELDFLREHIRIRRKP--------------NELCNTLNTNKTLV 104
            .||........:..:.    ::.:||||:.||.|:..              |...|..|.:.:|.
  Fly   118 RRELAHVKLMGNGFKPKWSLYEAMDFLRDVIRERKGASHATDLSLTTYGHINNNNNNNNNSNSLA 182

  Fly   105 PG---VTVD-----SQSADELALERNGITEFQPDEFIIEYKGEEEYLSETDNSSAEFISEDSACN 161
            .|   :|:.     ::||..|.|.:........|.:..:|..:.|........:....|..|:. 
  Fly   183 AGGKAMTLKLSNSFNESASVLNLSKCSSLNVSDDHYYCDYYVKPELDLSVGGGAGSSTSGSSSG- 246

  Fly   162 IGSELPYVTKPSFNGEGQSQT----QAKFMSVMNLIESALK 198
             |..||.....:.|....|.|    :|:..|..::.:|:::
  Fly   247 -GGPLPLPAHQAHNDSRVSSTRNEQRAQHHSYEDMDDSSIR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 18/95 (19%)
Mes2NP_730768.1 MADF 62..149 CDD:214738 14/86 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.