DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and CG12768

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster


Alignment Length:299 Identity:59/299 - (19%)
Similarity:102/299 - (34%) Gaps:93/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIASVKRNVSIFE---KYHTRYDRKQA--WIAVAQACQKSVEYCQIRWKSLRDRYVRET--QKPA 65
            ||..|:.|..:::   .::.|.|:::|  |..:.:....:.|..|..:.|||:.:.||.  :|..
  Fly    13 LIELVRLNPILWDCRLPHYKRSDKRKAIKWNELGRLFNVNGERVQRTFTSLREIFRRELNHEKML 77

  Fly    66 AT---RSNIRKFKELDFLREHIRIRR--------------------KPNELC---NTLNTN---- 100
            .|   :|....:..:.||:|.||.|:                    ..|..|   |:.|.|    
  Fly    78 GTTRFKSKWEYYDAMAFLKEVIRERKSRERIKHGSLDSAPVATGSSNNNNNCVSRNSSNNNSSSA 142

  Fly   101 --------------------------KTLVPGVTVDSQSAD----ELALERNG----ITEFQPDE 131
                                      |:.:| ||:.|.|..    .:||::..    ..:.|||.
  Fly   143 ALDEYQYFAPSDPNNPNNQPQLQPEPKSSLP-VTIPSLSLTLSQLPVALQQQAQHLQALQLQPDV 206

  Fly   132 FIIEYKGEEEYLSETD--------NSSAEFISEDSACNIGSELPYVTKPS----------FNGEG 178
            .:...:.:....|.|:        .|.|:.:|...:|:....:....:|.          ..|.|
  Fly   207 TLTSLQKQSLPTSLTNATPAPLAQTSPAQVLSSSRSCSSSPSIYIKDEPCSPAGGCPEEVMTGNG 271

  Fly   179 QSQTQAKFMSVMNLIESALKDKPAEPQDPFYKYLESILT 217
            ...|:.|..::....:..||   |..|.|..|...|..|
  Fly   272 PEATRKKLATIRPQTKQQLK---ARLQLPTPKNSSSYAT 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 21/86 (24%)
CG12768NP_001262229.1 MADF 12..100 CDD:214738 21/86 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.