DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and CG3919

DIOPT Version :10

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:201 Identity:44/201 - (21%)
Similarity:74/201 - (36%) Gaps:55/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VKRNVSIFEKYHTRYDR----KQAWIAVAQACQKSVEYCQIRWKSLRDRYVRETQKPAATRSNIR 72
            ||.:..:::::...|.|    |.||..::...:.||:.|:.||:::|..|.|..:......:...
  Fly    25 VKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKLHHGANTYYL 89

  Fly    73 KFKELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELALERNGITEFQPDEFIIEYK 137
            . .||.||::||                   .|||.|..:.           ...:|       |
  Fly    90 N-SELKFLQKHI-------------------TPGVPVPLRG-----------RRSRP-------K 116

  Fly   138 GEEEYLSETDNSSAEFISEDSACNIGSELPYVTKPSF-NGE-GQSQTQAKFMSVMNLIESALKDK 200
            |:||:......:..|.|           |..|..||| |.| .||:......|..::..:...::
  Fly   117 GQEEHDEGDPETPVEAI-----------LEMVHSPSFLNSEHAQSRHSTDPASATDVEATQFNNE 170

  Fly   201 PAEPQD 206
            |:...|
  Fly   171 PSSIMD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 20/76 (26%)
CG3919NP_001261840.1 MADF 20..100 CDD:214738 19/75 (25%)
BESS 226..260 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.