DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and CG3919

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:201 Identity:44/201 - (21%)
Similarity:74/201 - (36%) Gaps:55/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VKRNVSIFEKYHTRYDR----KQAWIAVAQACQKSVEYCQIRWKSLRDRYVRETQKPAATRSNIR 72
            ||.:..:::::...|.|    |.||..::...:.||:.|:.||:::|..|.|..:......:...
  Fly    25 VKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKLHHGANTYYL 89

  Fly    73 KFKELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELALERNGITEFQPDEFIIEYK 137
            . .||.||::||                   .|||.|..:.           ...:|       |
  Fly    90 N-SELKFLQKHI-------------------TPGVPVPLRG-----------RRSRP-------K 116

  Fly   138 GEEEYLSETDNSSAEFISEDSACNIGSELPYVTKPSF-NGE-GQSQTQAKFMSVMNLIESALKDK 200
            |:||:......:..|.|           |..|..||| |.| .||:......|..::..:...::
  Fly   117 GQEEHDEGDPETPVEAI-----------LEMVHSPSFLNSEHAQSRHSTDPASATDVEATQFNNE 170

  Fly   201 PAEPQD 206
            |:...|
  Fly   171 PSSIMD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 20/76 (26%)
CG3919NP_001261840.1 MADF 20..100 CDD:214738 19/75 (25%)
BESS 226..260 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.