DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and stwl

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001261839.1 Gene:stwl / 39581 FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster


Alignment Length:256 Identity:57/256 - (22%)
Similarity:102/256 - (39%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLIASVKRNVSIF----EKYHTRYDRKQAWIAVAQACQKSVEYCQIRWKSLRDRYVRETQKPAAT 67
            :|:.||::..:::    |.|..|...:.||..||....:|||.|:.||:.||:.|.|.....|..
  Fly    10 MLLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNADANR 74

  Fly    68 RSNIRK------FKELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELALERNGITE 126
            |.|.::      ..||.||..|:.|                      .|..:||:   :|:..::
  Fly    75 RRNGQRRLAYPLADELRFLDRHLNI----------------------ADDMAADD---DRSVSSD 114

  Fly   127 FQPDEFIIEYKGEEEY----LSETDNSSAEFISE-DSACNIGSELPYVTK-PSFNGEGQSQTQAK 185
            ...|. ..:.:|.:.:    |.|..:|:::.:.| ..|..:..|.....| .::...|..|...|
  Fly   115 KDRDN-NRDSEGVDHHAQASLKERASSTSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRK 178

  Fly   186 FMSVMNLIESALKDKPAEPQDPFYKYLESIL--TGVDDSTRIDIQLKVLNFVSDEIKRSRQ 244
            ..:...|.:....|:|.:..:     |:|.|  ...||....:..|:.|.....::::|.|
  Fly   179 KSAEEKLNDLEESDEPEKVPE-----LDSFLQSDNEDDECMDEEHLEDLEGFDFDLEQSNQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 28/86 (33%)
stwlNP_001261839.1 MADF 11..98 CDD:214738 28/86 (33%)
BESS 604..637 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.