DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and hng1

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:226 Identity:49/226 - (21%)
Similarity:96/226 - (42%) Gaps:34/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDGFDALLIASVKRNVSIFE----KYHTRYDRKQAWIAVAQACQKSVEYCQIRWKSLRDRYVRET 61
            :|..|.|||.:::...|:::    .:.....:::.|..||.....|:...:.||..|||||.||.
  Fly     8 LDDSDILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSREL 72

  Fly    62 QK----PAATRSNIRKFKELDFLREHIRIRR-----------KPN--ELCNTLNTNKTLVPGVTV 109
            ::    |:....:...|:::||||:.:|.||           ||.  ...:.....:|.:|   :
  Fly    73 KQKRLHPSGEFGHNDFFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVDLQRRRRTRLP---I 134

  Fly   110 DSQSADELALERNGITEFQPDEFIIEYKGE-EEYLSETDNSSAEFISEDSACNIGSELPYVTKPS 173
            |:    |..:|..|...:...|...:|..: |.:.::::..|....::|     |.|....:...
  Fly   135 DT----ETLIEEQGSHAYDEGEEQHDYDAKLESHTTQSETYSVVVEADD-----GQEPEQESFDE 190

  Fly   174 FNGEGQSQTQAKFMSVMNLIESALKDKPAEP 204
            |.|:.:.:.:.|.:::...|.:.......||
  Fly   191 FLGDAECEQKVKVVTIHPEIAAPNATSAPEP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 22/84 (26%)
hng1NP_611558.2 MADF 15..98 CDD:214738 22/82 (27%)
BESS 264..298 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.