DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and Coop

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster


Alignment Length:325 Identity:63/325 - (19%)
Similarity:109/325 - (33%) Gaps:103/325 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIASVKRNVSIFEKYHT----RYDRKQAWIAVAQACQKSVEYCQIRWKSLRDR----YVRETQKP 64
            |||:|.|...::.:.:.    |.|....|..|.|......:.|:|:|..|||.    |:|.... 
  Fly    43 LIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRNNLS- 106

  Fly    65 AATRSNIRKFKELDFLRE--HIRIRRKPNELCNTLNTNKTLVPGVTVDSQSA------DELAL-- 119
            ..|.|:.|.:.::.|:..  |..|.|:      |.:::|...||...::.:.      |.:.:  
  Fly   107 NETPSSWRFYNDMRFMEPAVHENIMRQ------TRSSSKKHPPGHWTENNNVLGPDKYDSMPIVA 165

  Fly   120 ------------------ERNGITEF------QPDEFIIEYKGEEEYLSETDNSSAEFISEDSAC 160
                              ..:.|:.|      ||.| ...:|.|.....|.:....:|..:.::.
  Fly   166 TEPICELSHSYDSELHQPSFSDISSFFEDRDCQPPE-NKRFKSEPSQREEDEEDDDDFDEDAASE 229

  Fly   161 NIGSEL------------------------PYVTKPSFNGEG------QSQTQAKFMSVMNLIES 195
            |:..|.                        ..|||...|...      :|:.:||   |.:..:|
  Fly   230 NLEEERGNRADAASSGVFTIEVLDDDDEMEQAVTKTKANNTSHGGSSLKSEQEAK---VFSNSQS 291

  Fly   196 ALKDKP--------AEPQDP------------FYKYLESILTGVDDSTRIDIQLKVLNFVSDEIK 240
            ...|.|        |...||            |...|...|..:|...|:.::.|:.|.:.:|::
  Fly   292 PTADLPFKYISTDVATNTDPSGGDLQDEADRMFLLSLMPFLQRLDSRRRLRVRQKLQNVLIEELE 356

  Fly   241  240
              Fly   357  356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 23/86 (27%)
CoopNP_001260776.1 MADF 42..124 CDD:214738 22/81 (27%)
BESS 320..353 CDD:281011 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.