DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and CG10949

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:305 Identity:64/305 - (20%)
Similarity:109/305 - (35%) Gaps:86/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIASVKRNVSIFEKYHTRYD-----RKQAWIAVAQACQKSVEYCQIRWKSLRDRYVRETQKPAAT 67
            ||..||.:..:::::..|..     :.:||..:::....|.|.|..|||.||||:.||.:.....
  Fly   141 LIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYNRWKKLRDRFGREFRSHQIN 205

  Fly    68 RS---NIRKFKELDFLREHIR---------IRR--KPNELCNTLNTNKTLVPGVTVDS------- 111
            :|   ..|.|.:|.||..|.|         |:|  :|.:..|..........|:.:.|       
  Fly   206 QSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNPSGKTSKQPEGMVISSGEQIWGA 270

  Fly   112 ---QSADELALERNGITEFQPDEFIIEYKGEEEYLSETDNSSA-EFISEDSACNIGSELPY---- 168
               .|.|...||         |:..:.|..|.|.|||.:.::. :||..::......|.|.    
  Fly   271 DYPYSTDNDDLE---------DDLELAYDEEIEILSEAEQATPYDFILSEATARQDLEPPQQLQV 326

  Fly   169 -VTKPSFNGE-------------------GQSQTQAK-----FMSVMNLIESAL----------- 197
             .|.|:.:.|                   |.|...|.     ..:|:..:|:.|           
  Fly   327 TTTTPATSEEIIHTIARVNPVVEESSSLPGDSVPSAAISDKLLTTVIANMETVLQQSRELQAQIH 391

  Fly   198 -------KDKPAEPQDPFYKYLESILTGVDDSTRIDIQLKVLNFV 235
                   :.:..:|.:......:.:|.|:..|.|...:.|::.|:
  Fly   392 HEQEQEREQRSTQPANSLLAKAQMLLDGLSPSERASAERKIVQFL 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 26/84 (31%)
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 26/84 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.