DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and CG8119

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster


Alignment Length:237 Identity:51/237 - (21%)
Similarity:93/237 - (39%) Gaps:73/237 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIASVKRNVSIFE---KYHTRYDRKQA---WIAVAQACQKSVEYCQIRWKSLRDRYVRETQKPAA 66
            |:..:....||::   |:..|  |.|.   |:.|:.|....|:.|:.||||||:.|         
  Fly    18 LLREIALRPSIWDSRIKFSLR--RPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNY--------- 71

  Fly    67 TRSNIRK--------FKELDFLRE-----------HIRIRRKPNELCNTLNTNKTLVPGVTVDSQ 112
             |:.|.:        .|:::|:|:           ..|::.|.::|  .|:..:.|        |
  Fly    72 -RTKIHQGNAWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKSKL--ILHPQQYL--------Q 125

  Fly   113 S-ADELALERNGITEFQPDEFIIEYKGEEEYLSETDNSSAEF-ISEDSACNIGSE-------LPY 168
            | |...|.::.|          ||::.||.....||..:.:. :.|:....:|::       |.:
  Fly   126 SVASYSAFKKGG----------IEFEAEERLFLVTDEPAFDLDVDEEVTRLLGTDQWLWQTNLDF 180

  Fly   169 VTKPSFNGEGQS-------QTQAKFMSVMNLIESALKDKPAE 203
            :..|.|.....|       ::...|:..|..:..:|.|:..|
  Fly   181 ILLPIFRAPPPSAMAKISNESNRHFLLSMVPMLRSLSDRSKE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 24/101 (24%)
CG8119NP_573050.1 MADF 17..97 CDD:214738 24/90 (27%)
BESS 201..234 CDD:281011 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.