DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and CG45071

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster


Alignment Length:218 Identity:47/218 - (21%)
Similarity:75/218 - (34%) Gaps:64/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KQAWIAVAQACQKSVEYCQIRWKSLRDRYVRETQK------------PAATRSNIRKFKELDFLR 81
            :|.|..::.|.:......:.:||.|||.:..|.::            ||...|....:..|.||.
  Fly    38 EQMWDELSGAHKLPKIVLKAKWKGLRDNFRVEYKRIPRADNGDFMVDPATFESKWLHYYALLFLT 102

  Fly    82 EHIRIRRKPNEL------------CNTLNTNKTLVPGVTVDSQSADELALERNGITEFQPDEFII 134
            :|:|.|...||.            |........|..|:....|.:||                  
  Fly   103 DHMRHRLPKNEQDQSFYFSQQSEDCEKTVVEPDLTNGLIRRLQDSDE------------------ 149

  Fly   135 EYKGEEEYLSETDNSSAEFISEDS-----ACNIGSELPYVTKPSFNGEGQSQTQAK--------- 185
            :|..||   .|.|..::|...|::     |.:..:::.  |.|...|..::|.:|.         
  Fly   150 DYDEEE---MEADGEASEATMEETMPTPPAAHQMNQVS--TTPLATGALRAQEEAHQHALIKAGL 209

  Fly   186 -FMSVMNLIESA--LKDKPAEPQ 205
             ...:|.|.:.|  |..||..||
  Fly   210 LRAQLMELEKEAEDLSRKPPPPQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 16/67 (24%)
CG45071NP_730024.1 MADF 14..106 CDD:214738 16/67 (24%)
BESS 384..418 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.