DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and madf-9

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 / 191167 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans


Alignment Length:297 Identity:67/297 - (22%)
Similarity:115/297 - (38%) Gaps:83/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDALLIASVKRNVSIFEKYHTRYD----RKQAWIAVAQACQKSVEYCQIRWKSLRDRYVRETQKP 64
            |:..|||.||....::::....|:    |..||..:|:..:.:.|:.:.|||:|||||.:|.:|.
 Worm    49 FNIRLIAEVKARPFLYDQSDEGYNLLSWRNSAWNEIAENLETTSEHVKTRWKTLRDRYKKEEKKE 113

  Fly    65 AATR--SNIRKFKELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDS-QSADELALERNGITE 126
            ..::  |:....:.|.|::.|::.|          :|::|       || ||...:..|.||  .
 Worm   114 RVSKKASSWVFQRPLKFIQAHLKDR----------HTDET-------DSNQSEPAVKPEPNG--H 159

  Fly   127 FQPDEFIIEY-----------------KGEEEYLSETDNSSAEFISEDSACNIGSELPYVTKP-- 172
            ..|.|..:.:                 .||.|..|.:..|||. .|:::....|.|...:|.|  
 Worm   160 VSPMEAAMSFIENELIRTQDSSKSSGSTGEMESSSASTASSAS-SSKNTGTQEGGEASVITPPPL 223

  Fly   173 ---------------SFNG------------EGQSQTQAKFMSVMNLIESALKDKPA-------- 202
                           :.||            ||.:...::..:........|...|.        
 Worm   224 PIPMAVTPSPSATSSASNGGPAVKRSRVSITEGMTPVASRNAAAAAAASLGLSFFPGLSQWATTR 288

  Fly   203 -EPQDPFYKYLESI-LTGVDDSTRIDIQLKVLNFVSD 237
             |.:|..:..:.|| |:.:|..|:...:|:||..:.|
 Worm   289 EEEEDEIFARMISIKLSKLDARTKEVAKLQVLKAIFD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 25/82 (30%)
madf-9NP_500389.2 MADF 52..136 CDD:214738 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.