DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42526 and si:ch73-59f11.3

DIOPT Version :9

Sequence 1:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001315046.1 Gene:si:ch73-59f11.3 / 107988036 ZFINID:ZDB-GENE-131121-446 Length:180 Species:Danio rerio


Alignment Length:177 Identity:34/177 - (19%)
Similarity:57/177 - (32%) Gaps:68/177 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KRNVSIFEKYHTRYDRK-----------QAWIAVAQACQ-KSVEYCQIRWKSLRDRYVRETQKPA 65
            :|...:.:.|...||..           .:|..:|.... .:.|.|:..|:::||::.:      
Zfish     6 RRVAELVKLYPHLYDHSLRDFKVPEKVFNSWKEIATKLGIDNPETCKSTWRNIRDKFSK------ 64

  Fly    66 ATRSNIRK-----------FKELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELAL 119
            |.:..:||           |.||.:||..:|:|      .||::....                 
Zfish    65 AMKRMLRKGGDEDARVPRLFVELKWLRPFVRLR------ANTVSDTPC----------------- 106

  Fly   120 ERNGITEFQPDEFIIEYKGEEEYLSETDNSSAEFISEDSACNIGSEL 166
                        |..|.:.||    ...|..||..|..|.|...|::
Zfish   107 ------------FEFEIQNEE----TPKNMVAEESSSSSGCTNESDV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42526NP_001163401.1 MADF 8..85 CDD:214738 19/94 (20%)
si:ch73-59f11.3NP_001315046.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.