powered by:
Protein Alignment CG42537 and AT1G01310
DIOPT Version :9
Sequence 1: | NP_001163530.1 |
Gene: | CG42537 / 8674074 |
FlyBaseID: | FBgn0260645 |
Length: | 90 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_171638.2 |
Gene: | AT1G01310 / 839333 |
AraportID: | AT1G01310 |
Length: | 241 |
Species: | Arabidopsis thaliana |
Alignment Length: | 38 |
Identity: | 10/38 - (26%) |
Similarity: | 14/38 - (36%) |
Gaps: | 1/38 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 PRGRLSCEGGKNEGFGGRHCRRTAMDEMWYYNQRTRKC 64
|.|......||| .:..|.......||..:|:.:...|
plant 133 PYGENIFWAGKN-NWSPRDIVNVWADEDKFYDVKGNTC 169
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.