DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42537 and Crispld1

DIOPT Version :9

Sequence 1:	NP_001163530.1	Gene:	CG42537 / 8674074	FlyBaseID:	FBgn0260645	Length:	90	Species:	Drosophila melanogaster
Sequence 2:	NP_001343480.1	Gene:	Crispld1 / 83691	MGIID:	1934666	Length:	500	Species:	Mus musculus

Alignment Length:	134	Identity:	24/134 - (17%)
Similarity:	37/134 - (27%)	Gaps:	55/134 - (41%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 VLACVVLYVSLACGQNRCDGRPRGRLSCEGG----KNEGFGGRH-------CRR----------- 48
            :::|.|..      :::|.|....|..|..|    |.:..|..|       ||.
Mouse   292 IVSCEVRL------RDQCKGTTCNRYECPAGCLDSKAKVIGSVHYEMQSSICRAAIHYGIIDNEG 350

  Fly    49 -----TAMDEMWYYNQRTRKCLKM--KY---------------LGCGGNQNRYCSLR----HCQR 87
                 |......|:.:..|..::.  ||               :.|.....:.|...    ||.|
Mouse   351 GWVDVTRQGRKHYFIKSNRNGIQTIGKYHSANSFTVSKVTVQAVTCETTVEQLCPFHKPASHCPR 415

  Fly    88 -SCP 90
             .||
Mouse   416 VYCP 419

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42537	NP_001163530.1	KU	<53..89	CDD:294074	9/57 (16%)
Crispld1	NP_001343480.1	CAP_CRISPLD1	62..207	CDD:349407
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	258..281
		LCCL	291..375	CDD:128866	15/88 (17%)
		LCCL	394..492	CDD:367672	7/26 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2340
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900