powered by:
Protein Alignment CG42537 and AT4G33730
DIOPT Version :9
Sequence 1: | NP_001163530.1 |
Gene: | CG42537 / 8674074 |
FlyBaseID: | FBgn0260645 |
Length: | 90 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_195099.1 |
Gene: | AT4G33730 / 829515 |
AraportID: | AT4G33730 |
Length: | 172 |
Species: | Arabidopsis thaliana |
Alignment Length: | 56 |
Identity: | 13/56 - (23%) |
Similarity: | 16/56 - (28%) |
Gaps: | 18/56 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 GKNEGFGGRHCRRTAMDEMW-----YYNQRTRKC-------------LKMKYLGCG 73
|:|..||...........|| ||:..:..| .....||||
plant 90 GENLAFGSGDMSAAQAVAMWVHEKSYYDFYSNSCHGPACGHYTQVVWRGSARLGCG 145
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42537 | NP_001163530.1 |
KU |
<53..89 |
CDD:294074 |
9/39 (23%) |
AT4G33730 | NP_195099.1 |
CAP_PR-1 |
39..172 |
CDD:349400 |
13/56 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.