DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42537 and Crispld2

DIOPT Version :9

Sequence 1:NP_001163530.1 Gene:CG42537 / 8674074 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:120 Identity:22/120 - (18%)
Similarity:30/120 - (25%) Gaps:49/120 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QNRCDGRPRGRLSCEGG----KNEGFGGRH-------CR------------------RTAMDEMW 55
            ::.|.|....|..|..|    |.:.||...       ||                  |..|...:
Mouse   293 KDSCKGSTCNRYQCPAGCLSNKAKVFGSLFYESSSSICRAAIHYGVIDDRGGLVDVTRNGMVPFF 357

  Fly    56 YYNQRTRKCLKMKY---------------LGCGGNQNRYCSLR----HCQR-SCP 90
            ..:|:.......||               :.|.....:.|...    ||.| .||
Mouse   358 VKSQKNGMESLSKYKPSSSFTVSKVTETAVDCHATVAQLCPFEKPATHCPRIQCP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 KU <53..89 CDD:294074 8/55 (15%)
Crispld2NP_001297564.1 CAP 56..201 CDD:381818
LCCL 284..368 CDD:128866 13/74 (18%)
LCCL 387..486 CDD:367672 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.