| Sequence 1: | NP_001163530.1 | Gene: | CG42537 / 8674074 | FlyBaseID: | FBgn0260645 | Length: | 90 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_693394.5 | Gene: | wfikkn2a / 564992 | ZFINID: | ZDB-GENE-120914-1 | Length: | 573 | Species: | Danio rerio |
| Alignment Length: | 45 | Identity: | 17/45 - (37%) |
|---|---|---|---|
| Similarity: | 23/45 - (51%) | Gaps: | 2/45 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 46 CRRTAMDEMWYYNQRTRKCLKMKYLGCGGNQNRYCSLRHCQRSCP 90 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42537 | NP_001163530.1 | Kunitz-type | 33..89 | CDD:444694 | 15/42 (36%) |
| wfikkn2a | XP_693394.5 | WAP | 41..90 | CDD:459672 | |
| KAZAL_FS | 137..173 | CDD:238052 | |||
| Ig | 209..303 | CDD:472250 | |||
| Ig strand B | 226..230 | CDD:409353 | |||
| Ig strand C | 239..243 | CDD:409353 | |||
| Ig strand E | 261..265 | CDD:409353 | |||
| Ig strand F | 283..288 | CDD:409353 | |||
| Ig strand G | 296..299 | CDD:409353 | |||
| Kunitz_WFIKKN_1-like | 324..375 | CDD:438648 | |||
| Kunitz_WFIKKN_2-like | 382..434 | CDD:438649 | 15/43 (35%) | ||
| NTR_WFIKKN | 451..559 | CDD:239630 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||