DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42537 and wfikkn2a

DIOPT Version :10

Sequence 1:NP_001163530.1 Gene:CG42537 / 8674074 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:XP_693394.5 Gene:wfikkn2a / 564992 ZFINID:ZDB-GENE-120914-1 Length:573 Species:Danio rerio


Alignment Length:45 Identity:17/45 - (37%)
Similarity:23/45 - (51%) Gaps:2/45 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CRRTAMDEMWYYNQRTRKCLKMKYLGCGGNQNRYCSLRHCQRSCP 90
            |:  |....|.|:...:||....|.|||||:|.:.|...|:..||
Zfish   392 CK--AYKPRWAYSHALKKCQSFVYGGCGGNENNFESKEACEEMCP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 Kunitz-type 33..89 CDD:444694 15/42 (36%)
wfikkn2aXP_693394.5 WAP 41..90 CDD:459672
KAZAL_FS 137..173 CDD:238052
Ig 209..303 CDD:472250
Ig strand B 226..230 CDD:409353
Ig strand C 239..243 CDD:409353
Ig strand E 261..265 CDD:409353
Ig strand F 283..288 CDD:409353
Ig strand G 296..299 CDD:409353
Kunitz_WFIKKN_1-like 324..375 CDD:438648
Kunitz_WFIKKN_2-like 382..434 CDD:438649 15/43 (35%)
NTR_WFIKKN 451..559 CDD:239630
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.