DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42537 and CG17380

DIOPT Version :10

Sequence 1:NP_001163530.1 Gene:CG42537 / 8674074 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster


Alignment Length:37 Identity:14/37 - (37%)
Similarity:21/37 - (56%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EMWYYNQRTRKCLKMKYLGCGGNQNRYCSLRHCQRSC 89
            ||:.|:.....|::..|.|||||.||:.:.:.|...|
  Fly    39 EMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 Kunitz-type 33..89 CDD:444694 13/35 (37%)
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 13/35 (37%)

Return to query results.
Submit another query.