DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42537 and CG42827

DIOPT Version :10

Sequence 1:NP_001163530.1 Gene:CG42537 / 8674074 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster


Alignment Length:58 Identity:20/58 - (34%)
Similarity:27/58 - (46%) Gaps:10/58 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SCEGGKNEGFGGRHCRRTAMDEMWYYNQRTRKCLKMKYLGCGGNQNRYCSLRHCQRSC 89
            |.|.||.:|      ||    ::|:||.:..||....|..||||.|.:.:...|...|
  Fly    44 SSEYGKCKG------RR----KLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 Kunitz-type 33..89 CDD:444694 18/55 (33%)
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 19/56 (34%)

Return to query results.
Submit another query.