DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42537 and CG13748

DIOPT Version :10

Sequence 1:NP_001163530.1 Gene:CG42537 / 8674074 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster


Alignment Length:44 Identity:16/44 - (36%)
Similarity:26/44 - (59%) Gaps:2/44 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CRRTAMDEMWYYNQRTRKCLKMKYLGCGGNQNRYCSLRHCQRSC 89
            ||  |:...|.|:...:||::.|:.||.||:|.:.|.:.|..:|
  Fly    69 CR--ALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 Kunitz-type 33..89 CDD:444694 15/42 (36%)
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 16/44 (36%)

Return to query results.
Submit another query.