| Sequence 1: | NP_001163530.1 | Gene: | CG42537 / 8674074 | FlyBaseID: | FBgn0260645 | Length: | 90 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_008760202.1 | Gene: | Tfpi / 29436 | RGDID: | 61914 | Length: | 306 | Species: | Rattus norvegicus |
| Alignment Length: | 44 | Identity: | 17/44 - (38%) |
|---|---|---|---|
| Similarity: | 26/44 - (59%) | Gaps: | 2/44 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 46 CRRTAMDEMWYYNQRTRKCLKMKYLGCGGNQNRYCSLRHCQRSC 89 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42537 | NP_001163530.1 | Kunitz-type | 33..89 | CDD:444694 | 16/42 (38%) |
| Tfpi | XP_008760202.1 | Kunitz_TFPI1_1-like | 50..104 | CDD:438656 | |
| Kunitz_TFPI1_2-like | 120..175 | CDD:438657 | |||
| Kunitz_TFPI1_TFPI2_3-like | 223..276 | CDD:438658 | 16/42 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||