DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42537 and B0222.5

DIOPT Version :10

Sequence 1:NP_001163530.1 Gene:CG42537 / 8674074 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_505373.1 Gene:B0222.5 / 181860 WormBaseID:WBGene00015056 Length:369 Species:Caenorhabditis elegans


Alignment Length:64 Identity:18/64 - (28%)
Similarity:30/64 - (46%) Gaps:3/64 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RPRGRLSCEGGKNEGFGGRHCRRTAMDEMWYYNQRTRKCLKMKYLGCGGNQNRYCSLRHCQRSC 89
            :|.|:..|...:|   .|..|.:......::::..|.:|...::.|||||||.|.:...|...|
 Worm   181 QPIGKPWCASNRN---AGHTCNQNKTSIRYWFDVETFQCFPFEHKGCGGNQNSYRTSSECYFDC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 Kunitz-type 33..89 CDD:444694 15/55 (27%)
B0222.5NP_505373.1 TY 22..84 CDD:238114
TY 87..154 CDD:238114
KU 186..241 CDD:197529 15/57 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.