DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42537 and R3HDML

DIOPT Version :9

Sequence 1:NP_001163530.1 Gene:CG42537 / 8674074 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_848586.1 Gene:R3HDML / 140902 HGNCID:16249 Length:253 Species:Homo sapiens


Alignment Length:39 Identity:7/39 - (17%)
Similarity:11/39 - (28%) Gaps:20/39 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DEMWYYNQRTRKCLKMKYLGCGGNQNRYCSLRHCQRSCP 90
            :|.|:|                    .:.:.|.|...||
Human   140 EEKWHY--------------------LFPAPRDCNPHCP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 KU <53..89 CDD:294074 5/35 (14%)
R3HDMLNP_848586.1 SCP 65..207 CDD:320774 7/39 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.