DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42537 and CG42713

DIOPT Version :10

Sequence 1:NP_001163530.1 Gene:CG42537 / 8674074 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster


Alignment Length:90 Identity:51/90 - (56%)
Similarity:63/90 - (70%) Gaps:3/90 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLLVLACVVLYVSLACGQNRCDGRPRGRLSCEGGKNEGF-GGRHCRRTAMDEMWYYNQRTRKC 64
            ||.||:||.|||||:|:..|: |.||| ...:|..||:||. ..|||.|....:|||||||..:|
  Fly     1 MKFLLILASVVLYVALSSAQS-CPGRP-SHQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRC 63

  Fly    65 LKMKYLGCGGNQNRYCSLRHCQRSC 89
            :||:||||.||:||||:|..|||.|
  Fly    64 IKMRYLGCKGNRNRYCTLNECQRKC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 Kunitz-type 33..89 CDD:444694 33/56 (59%)
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 33/56 (59%)

Return to query results.
Submit another query.