DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42537 and CG42713

DIOPT Version :9

Sequence 1:NP_001163530.1 Gene:CG42537 / 8674074 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster


Alignment Length:90 Identity:51/90 - (56%)
Similarity:63/90 - (70%) Gaps:3/90 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLLVLACVVLYVSLACGQNRCDGRPRGRLSCEGGKNEGF-GGRHCRRTAMDEMWYYNQRTRKC 64
            ||.||:||.|||||:|:..|: |.||| ...:|..||:||. ..|||.|....:|||||||..:|
  Fly     1 MKFLLILASVVLYVALSSAQS-CPGRP-SHQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRC 63

  Fly    65 LKMKYLGCGGNQNRYCSLRHCQRSC 89
            :||:||||.||:||||:|..|||.|
  Fly    64 IKMRYLGCKGNRNRYCTLNECQRKC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 KU <53..89 CDD:294074 24/35 (69%)
CG42713NP_001188736.1 KU <54..89 CDD:294074 24/35 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.