powered by:
Protein Alignment CG42554 and C7orf25
DIOPT Version :9
Sequence 1: | NP_001163314.1 |
Gene: | CG42554 / 8674073 |
FlyBaseID: | FBgn0260756 |
Length: | 213 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016868085.1 |
Gene: | C7orf25 / 79020 |
HGNCID: | 21703 |
Length: | 435 |
Species: | Homo sapiens |
Alignment Length: | 40 |
Identity: | 11/40 - (27%) |
Similarity: | 17/40 - (42%) |
Gaps: | 7/40 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 GSAQSVAKAIDKTVQDFDAKFTSSLVAKASSTLAHSEPHM 147
|..|...|:|.:..:|| |.|.....:.:|.||:
Human 147 GRGQYGDKSIIEQAEDF-------LQASHQQPVQYSNPHI 179
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42554 | NP_001163314.1 |
NRBF2_MIT |
4..>64 |
CDD:319187 |
|
C7orf25 | XP_016868085.1 |
DUF1308 |
52..415 |
CDD:284430 |
11/40 (28%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.