DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42554 and C7orf25

DIOPT Version :9

Sequence 1:NP_001163314.1 Gene:CG42554 / 8674073 FlyBaseID:FBgn0260756 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_016868085.1 Gene:C7orf25 / 79020 HGNCID:21703 Length:435 Species:Homo sapiens


Alignment Length:40 Identity:11/40 - (27%)
Similarity:17/40 - (42%) Gaps:7/40 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GSAQSVAKAIDKTVQDFDAKFTSSLVAKASSTLAHSEPHM 147
            |..|...|:|.:..:||       |.|.....:.:|.||:
Human   147 GRGQYGDKSIIEQAEDF-------LQASHQQPVQYSNPHI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42554NP_001163314.1 NRBF2_MIT 4..>64 CDD:319187
C7orf25XP_016868085.1 DUF1308 52..415 CDD:284430 11/40 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.