DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42554 and Nrbf2

DIOPT Version :9

Sequence 1:NP_001163314.1 Gene:CG42554 / 8674073 FlyBaseID:FBgn0260756 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_036011832.1 Gene:Nrbf2 / 641340 MGIID:1354950 Length:316 Species:Mus musculus


Alignment Length:273 Identity:55/273 - (20%)
Similarity:101/273 - (36%) Gaps:89/273 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAHFHERRSERFIRNHRYEEAIKALETSLIYMQDAQKRVALPKSKEVLDTLTLDFQRKLRQIEMR 72
            |||...||::|.:...:|||||.....:..|:.:|.|   |.:|::.  .|:|:.||.....::.
Mouse    39 LAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMK---LTESEQA--HLSLELQRDSHMKQLL 98

  Fly    73 KTQHGLNKLKDYAPLK-------ETSPML--PLRPEAGASGGAGGSAQSVAKAIDKTVQD----F 124
            ..|....:.|....||       :.:|.|  |.||...|.|.:...:|....:.::.:.:    |
Mouse    99 LIQERWKRAKREERLKAQQSTERDGAPHLQAPPRPSEDAEGQSPLLSQPYIPSTERRLPEVQGVF 163

  Fly   125 D-------------------------AKFTSSLVAKASSTLAHSEPHM-------ETLKKSD--- 154
            |                         .|...:::.:.::.:|..:.|:       |.|:|.:   
Mouse   164 DRDPDTLLFLLQQKNEPSEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQL 228

  Fly   155 ----------SAQEEQEHD-----------------------TCDQRLAGSG---DLDLPSLAPL 183
                      :|::|.:.|                       |..:..|.:|   |:.:|:|.||
Mouse   229 KAEKARLLKGTAEKELDVDADFVEKSELWGLPSHSESAAASSTWQKFAANTGKAKDIPIPNLPPL 293

  Fly   184 ELPSFDYSLFTSS 196
            :.||.:..|...|
Mouse   294 DFPSPELPLMELS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42554NP_001163314.1 NRBF2_MIT 4..>64 CDD:319187 18/55 (33%)
Nrbf2XP_036011832.1 NRBF2_MIT 39..115 CDD:407297 23/80 (29%)
NRBF2 118..313 CDD:401057 31/189 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.