Sequence 1: | NP_001163314.1 | Gene: | CG42554 / 8674073 | FlyBaseID: | FBgn0260756 | Length: | 213 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036011832.1 | Gene: | Nrbf2 / 641340 | MGIID: | 1354950 | Length: | 316 | Species: | Mus musculus |
Alignment Length: | 273 | Identity: | 55/273 - (20%) |
---|---|---|---|
Similarity: | 101/273 - (36%) | Gaps: | 89/273 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 LAHFHERRSERFIRNHRYEEAIKALETSLIYMQDAQKRVALPKSKEVLDTLTLDFQRKLRQIEMR 72
Fly 73 KTQHGLNKLKDYAPLK-------ETSPML--PLRPEAGASGGAGGSAQSVAKAIDKTVQD----F 124
Fly 125 D-------------------------AKFTSSLVAKASSTLAHSEPHM-------ETLKKSD--- 154
Fly 155 ----------SAQEEQEHD-----------------------TCDQRLAGSG---DLDLPSLAPL 183
Fly 184 ELPSFDYSLFTSS 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42554 | NP_001163314.1 | NRBF2_MIT | 4..>64 | CDD:319187 | 18/55 (33%) |
Nrbf2 | XP_036011832.1 | NRBF2_MIT | 39..115 | CDD:407297 | 23/80 (29%) |
NRBF2 | 118..313 | CDD:401057 | 31/189 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167850868 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR14964 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |