DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42554 and nrbf2

DIOPT Version :9

Sequence 1:NP_001163314.1 Gene:CG42554 / 8674073 FlyBaseID:FBgn0260756 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001016183.1 Gene:nrbf2 / 548937 XenbaseID:XB-GENE-1008875 Length:296 Species:Xenopus tropicalis


Alignment Length:294 Identity:63/294 - (21%)
Similarity:96/294 - (32%) Gaps:127/294 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 APLNLAHFHERRSERFIRNHRYEEAIKALETSLIYMQDAQKRVALPKSKEVLDTLTLDFQR---- 64
            :||||||...|:::||:...:|||||...:.:..|:.:|:|   |.:|::.  .|:|:.||    
 Frog     6 SPLNLAHQQSRKADRFLATGKYEEAIACHKKAAAYLSEAKK---LTQSEQA--QLSLELQRESHI 65

  Fly    65 -----------KLRQIEMRKTQHGLNKLKDYAPLKETSPMLPLRPEAGASGG-----AGGSAQSV 113
                       :.|:.|..:||.     |.....:|.|..|.....:.|...     .|.:.|..
 Frog    66 KHQLLIQERLKRARREEKLRTQQ-----KAIVAERELSAHLQASYRSAADNADSQNTLGSAGQKS 125

  Fly   114 AKAIDKTVQDFDAKFTSSLVAKASSTLAH-----SEPHMETLK-----KSDSAQEEQEHDTCDQ- 167
            .....|.|||.     .|::.:...:|.:     .|| |||.|     |.|..:.|::..|..: 
 Frog   126 GSNPGKYVQDI-----PSVLDREPDSLMYLLQRRKEP-METCKVSKAPKDDKTKLEEQATTIKEL 184

  Fly   168 --------------------------RL------------------------------------- 169
                                      ||                                     
 Frog   185 NQLVDTLLAENEALRKENKKLRAEVARLQKNPEKDLDIDTDFVEKSELWNLQQPTGSAANPTSAW 249

  Fly   170 ------AGSG-----------DLDLPSLAPLELP 186
                  :|.|           |:.||.|.|||||
 Frog   250 QKFVAHSGKGTDIPIPNLPPLDIPLPELPPLELP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42554NP_001163314.1 NRBF2_MIT 4..>64 CDD:319187 21/59 (36%)
nrbf2NP_001016183.1 NRBF2_MIT 4..85 CDD:319187 25/83 (30%)
NRBF2 92..264 CDD:370212 26/177 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1613014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.