DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42554 and nrbf2b

DIOPT Version :9

Sequence 1:NP_001163314.1 Gene:CG42554 / 8674073 FlyBaseID:FBgn0260756 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001002613.1 Gene:nrbf2b / 436886 ZFINID:ZDB-GENE-040718-357 Length:247 Species:Danio rerio


Alignment Length:235 Identity:51/235 - (21%)
Similarity:88/235 - (37%) Gaps:59/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 APLNLAHFHERRSERFIRNHRYEEAIKALETSLIYMQDAQKRVALPKSKEVLDTLTLDFQRKLRQ 68
            :||||||...|:::|.:...::|:||.....:...:::|.|.....:::     |:|:.||....
Zfish     6 SPLNLAHQQCRKADRLLAAGKFEDAISCHRKAADLLKEAMKLTECEQAR-----LSLELQRDSHV 65

  Fly    69 IEMRKTQHGLNKLKDYAPLKETSPML------PLRPEAGASGGAGGSAQ---------------- 111
            .:.|..:....:.|     :|..|..      |.|.....:|.|..::|                
Zfish    66 KQQRLIEERWKRAK-----REDKPRTLQASEQPARRHLHPAGVADTTSQPPDREYDTWLYLLKNK 125

  Fly   112 ---------SVAKAIDK--------TVQDFDAKFTSSLVAKASSTLAHSE---PHMETLKKSDSA 156
                     |.|:..||        |:.|. .|....||::.......:|   .....|||...|
Zfish   126 GTVPEPCAGSKAQKDDKTRLEEQQTTINDL-RKLVDRLVSENQRLKQENERLCAENSRLKKEHYA 189

  Fly   157 QEEQE----HDTCDQRLAGSGDLDLPSLAPLELPSFDYSL 192
            ..:.|    ....::|.|  .|:.:|.|.|||:|:.:..|
Zfish   190 DADSELWVLPQPNEERKA--KDIPIPQLPPLEMPTQEIPL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42554NP_001163314.1 NRBF2_MIT 4..>64 CDD:319187 15/59 (25%)
nrbf2bNP_001002613.1 DUF1875 46..243 CDD:286100 39/195 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1613014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.