DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42554 and NRBF2

DIOPT Version :9

Sequence 1:NP_001163314.1 Gene:CG42554 / 8674073 FlyBaseID:FBgn0260756 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_110386.2 Gene:NRBF2 / 29982 HGNCID:19692 Length:287 Species:Homo sapiens


Alignment Length:282 Identity:62/282 - (21%)
Similarity:107/282 - (37%) Gaps:101/282 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PLNLAHFHERRSERFIRNHRYEEAIKALETSLIYMQDAQKRVALPKSKEVLDTLTLDFQR--KLR 67
            ||||||...||::|.:...:|||||...:.:..|:.:|.|   |.:|::.  .|:|:.||  .::
Human     7 PLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMK---LTQSEQA--HLSLELQRDSHMK 66

  Fly    68 QI-------------EMRKTQHGLNKLKDYAPLKETSPMLPLRPEAGASGGAGGSAQSVAKAIDK 119
            |:             |..|.|.  |..||.|...:||.    :|.|..:.|....:|..:.:.:|
Human    67 QLLLIQERWKRAQREERLKAQQ--NTDKDAAAHLQTSH----KPSAEDAEGQSPLSQKYSPSTEK 125

  Fly   120 TVQD----FD-------------------------AKFTSSLVAKASSTLAHSEPHMETL----- 150
            .:.:    ||                         .|...:::.:.::.:|..:.|:|.|     
Human   126 CLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENE 190

  Fly   151 --------KKSDSAQ-----EEQEHD-------------------------TCDQRLAGSG---D 174
                    .|::.|:     .|:|.|                         |..:..|.:|   |
Human   191 RLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKD 255

  Fly   175 LDLPSLAPLELPSFDYSLFTSS 196
            :.:|:|.||:.||.:..|...|
Human   256 IPIPNLPPLDFPSPELPLMELS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42554NP_001163314.1 NRBF2_MIT 4..>64 CDD:319187 21/58 (36%)
NRBF2NP_110386.2 NRBF2_MIT 4..86 CDD:319187 25/83 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..122 12/44 (27%)
NRBF2 89..284 CDD:312498 35/193 (18%)
Nuclear receptor interaction motif 141..145 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1613014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.