Sequence 1: | NP_001163314.1 | Gene: | CG42554 / 8674073 | FlyBaseID: | FBgn0260756 | Length: | 213 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_110386.2 | Gene: | NRBF2 / 29982 | HGNCID: | 19692 | Length: | 287 | Species: | Homo sapiens |
Alignment Length: | 282 | Identity: | 62/282 - (21%) |
---|---|---|---|
Similarity: | 107/282 - (37%) | Gaps: | 101/282 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 PLNLAHFHERRSERFIRNHRYEEAIKALETSLIYMQDAQKRVALPKSKEVLDTLTLDFQR--KLR 67
Fly 68 QI-------------EMRKTQHGLNKLKDYAPLKETSPMLPLRPEAGASGGAGGSAQSVAKAIDK 119
Fly 120 TVQD----FD-------------------------AKFTSSLVAKASSTLAHSEPHMETL----- 150
Fly 151 --------KKSDSAQ-----EEQEHD-------------------------TCDQRLAGSG---D 174
Fly 175 LDLPSLAPLELPSFDYSLFTSS 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42554 | NP_001163314.1 | NRBF2_MIT | 4..>64 | CDD:319187 | 21/58 (36%) |
NRBF2 | NP_110386.2 | NRBF2_MIT | 4..86 | CDD:319187 | 25/83 (30%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 83..122 | 12/44 (27%) | |||
NRBF2 | 89..284 | CDD:312498 | 35/193 (18%) | ||
Nuclear receptor interaction motif | 141..145 | 0/3 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165160520 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1613014at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR14964 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.040 |