DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42554 and AW209491

DIOPT Version :9

Sequence 1:NP_001163314.1 Gene:CG42554 / 8674073 FlyBaseID:FBgn0260756 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001098116.1 Gene:AW209491 / 105351 MGIID:2145422 Length:421 Species:Mus musculus


Alignment Length:100 Identity:22/100 - (22%)
Similarity:38/100 - (38%) Gaps:12/100 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LRQIEMRKTQHG----LNKLKDYAPLKETSPMLPLRPEAGASGGAGGSAQSVAKAIDKTVQDFDA 126
            |..|.:.:.|:|    :.:.:|:.......|:....|..     ......||:..:...::|...
Mouse   127 LHNIWLGRGQYGDKSIIEQAEDFLQASRQQPVQYSNPHI-----VFAFYNSVSSPMADKLKDMGI 186

  Fly   127 KFTSSLVAKASSTLAHSEPHMETLKKSDSAQEEQE 161
            .....:|| .:|.|.|.|...  |.:|:|..|.||
Mouse   187 SVRGDIVA-VNSLLNHPEEFQ--LSESESDDEGQE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42554NP_001163314.1 NRBF2_MIT 4..>64 CDD:319187
AW209491NP_001098116.1 DUF1308 38..401 CDD:284430 21/99 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5955
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.