DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42554 and LOC100363472

DIOPT Version :9

Sequence 1:NP_001163314.1 Gene:CG42554 / 8674073 FlyBaseID:FBgn0260756 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_002728120.1 Gene:LOC100363472 / 100363472 RGDID:2322973 Length:287 Species:Rattus norvegicus


Alignment Length:282 Identity:57/282 - (20%)
Similarity:105/282 - (37%) Gaps:101/282 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PLNLAHFHERRSERFIRNHRYEEAIKALETSLIYMQDAQKRVALPKSKEVLDTLTLDFQR----- 64
            ||||||...||::|.:...:|||||...:.:..|:.:|.|   |.:|::.  .|:|:.||     
  Rat     7 PLNLAHQQSRRADRLLAAGKYEEAISCHKKATAYLSEAMK---LTQSEQA--HLSLELQRDSHMK 66

  Fly    65 ----------KLRQIEMRKTQHGLNKLKDYAPLKETSPMLPLRPEAGASGGAGGSAQSVAKAIDK 119
                      :.::.|..|.|...:  :|..|..:.|.    ||...:.|.:...:|:...:.:|
  Rat    67 QLLLIQERWKRAKREERLKAQQSTD--RDGVPHLQASH----RPSEDSEGQSPLLSQTDIPSTEK 125

  Fly   120 TVQD----FD-------------------------AKFTSSLVAKASSTLAHSEPHM-------E 148
            .:.:    ||                         .|...:::.:.::.:|..:.|:       |
  Rat   126 RLPEVQGVFDRDPDTLLFLLQQKNEPSEPCIGSKAPKDDKTIIEEQATKIAELKRHVEFLVAENE 190

  Fly   149 TLKKSDS-------------AQEEQEHD-----------------------TCDQRLAGSG---D 174
            .|:|.:.             |::|.:.|                       |..:..|.:|   |
  Rat   191 RLRKENKQLKAEKARLLKGPAEKELDVDADFVEKSELWGLPPHSDTATASSTWQKFAANTGKAKD 255

  Fly   175 LDLPSLAPLELPSFDYSLFTSS 196
            :.:|:|.||:.||.:..|...|
  Rat   256 IPIPNLRPLDFPSPELPLMELS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42554NP_001163314.1 NRBF2_MIT 4..>64 CDD:319187 21/58 (36%)
LOC100363472XP_002728120.1 DUF1875 46..284 CDD:286100 41/243 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1613014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.