DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42516 and AT3G15420

DIOPT Version :9

Sequence 1:NP_001163086.1 Gene:CG42516 / 8674068 FlyBaseID:FBgn0260390 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_188161.1 Gene:AT3G15420 / 820781 AraportID:AT3G15420 Length:107 Species:Arabidopsis thaliana


Alignment Length:102 Identity:23/102 - (22%)
Similarity:46/102 - (45%) Gaps:17/102 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DAAIKIIGIESDTPMAEVNGSI-YRGRYEHSVGTNVFFEKEKDNLASDPLFESVCRQRYQYVDKS 96
            ||...:.|:::..|:..::|.| ..|.|..::||.:.|.::::..||:.  :...::..:.|.|.
plant    22 DAPYTLSGLDTLNPVLTIDGKIKLVGEYIETIGTCLAFSEKEEVSASEN--QMPHKKIIEPVAKL 84

  Fly    97 TKVISFERVYVDNLHQEVEKSAETEEDDQTEPKPESL 133
            .|::.|....:||              |..|.|..:|
plant    85 HKILKFRLAALDN--------------DDGETKTNNL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42516NP_001163086.1 TFIIIC_sub6 36..69 CDD:287402 8/33 (24%)
AT3G15420NP_188161.1 TFIIIC_sub6 25..59 CDD:287402 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21860
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.