DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42516 and Gtf3c6

DIOPT Version :9

Sequence 1:NP_001163086.1 Gene:CG42516 / 8674068 FlyBaseID:FBgn0260390 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001346420.1 Gene:Gtf3c6 / 67371 MGIID:1914621 Length:228 Species:Mus musculus


Alignment Length:125 Identity:32/125 - (25%)
Similarity:56/125 - (44%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DSSDSEYEDTEYLVFADFKNHIHPHQLKHEDAAIKIIGIESDTPMAEVNGSIYRGRYEHSVGTNV 67
            :..:.|.|:.|..|..:....|....|...:...||:||:::.|:.:|:..::.|.||.::||.|
Mouse    19 EEEEEELEEVEQFVLVELSGIIDSDFLSKCENKCKILGIDTERPIMQVDSYVFAGEYEDTLGTCV 83

  Fly    68 FFEKEKDNLASDPLFESVCRQRYQYVDKSTKVISFERVYVDNLHQEVEKSAETEEDDQTE 127
            .||:..:.:  ||  |...:...:|...:.|.:|..|..:      .||....|..|..|
Mouse    84 IFEEGVERV--DP--EGTDKTVLKYKCHTMKKLSMTRTLL------TEKKEGEENIDGVE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42516NP_001163086.1 TFIIIC_sub6 36..69 CDD:287402 12/32 (38%)
Gtf3c6NP_001346420.1 TFIIIC_sub6 52..85 CDD:313617 12/32 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850290
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AAV2
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008230
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107369
Panther 1 1.100 - - LDO PTHR21860
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.