DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42516 and gtf3c6

DIOPT Version :9

Sequence 1:NP_001163086.1 Gene:CG42516 / 8674068 FlyBaseID:FBgn0260390 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_956556.1 Gene:gtf3c6 / 393232 ZFINID:ZDB-GENE-040426-1009 Length:183 Species:Danio rerio


Alignment Length:131 Identity:33/131 - (25%)
Similarity:62/131 - (47%) Gaps:20/131 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DSEYEDTEYLVFADFKNHIHPHQLKHEDAAIKIIGIESDTPMAEVNGSIYRGRYEHSVGTNVFFE 70
            :.|:|:.|.:|.|:....|:...:.:.....||:.|:|:.||.:|...::.|.||.::||.|.| 
Zfish     2 EDEWEEEEQMVVAELSGMINSDLISNRQGTCKIVDIDSEQPMLQVGRYLFTGEYEDAIGTCVIF- 65

  Fly    71 KEKDNLASDPLFESVCRQRYQYVDKSTKVISFERVYVDNLHQEVEKSAETEEDDQTEPKPESLKL 135
             |:|..:|:...:..|.        :.|.:..:|.::          :|.:||:....:.|.|.|
Zfish    66 -EEDRSSSNAALKYKCH--------TMKKLMLQRTFL----------SERKEDEPVSNRIEVLAL 111

  Fly   136 N 136
            |
Zfish   112 N 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42516NP_001163086.1 TFIIIC_sub6 36..69 CDD:287402 13/32 (41%)
gtf3c6NP_956556.1 TFIIIC_sub6 32..65 CDD:287402 13/32 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596198
Domainoid 1 1.000 47 1.000 Domainoid score I12073
eggNOG 1 0.900 - - E1_2AAV2
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5456
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008230
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107369
Panther 1 1.100 - - LDO PTHR21860
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.