DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42516 and Gtf3c6

DIOPT Version :9

Sequence 1:NP_001163086.1 Gene:CG42516 / 8674068 FlyBaseID:FBgn0260390 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001102007.1 Gene:Gtf3c6 / 361858 RGDID:1307434 Length:227 Species:Rattus norvegicus


Alignment Length:126 Identity:33/126 - (26%)
Similarity:56/126 - (44%) Gaps:11/126 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DSSDSEYE-DTEYLVFADFKNHIHPHQLKHEDAAIKIIGIESDTPMAEVNGSIYRGRYEHSVGTN 66
            |..:.|.| :.|..|..:....|....|...:...||:||:::.|:.:|:..::.|.||.::||.
  Rat    19 DEEEEEEEIEEEQFVLVELSGIIDTDFLSKCENKCKILGIDTERPILQVDSYVFAGEYEDTLGTC 83

  Fly    67 VFFEKEKDNLASDPLFESVCRQRYQYVDKSTKVISFERVYVDNLHQEVEKSAETEEDDQTE 127
            |.||:..:.:  ||  |...:...:|...:.|.:|..|..:      .||....|..|..|
  Rat    84 VIFEEGVERV--DP--EGNDKTVLKYKCHTMKKLSMTRTLL------TEKKEGEENIDGVE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42516NP_001163086.1 TFIIIC_sub6 36..69 CDD:287402 12/32 (38%)
Gtf3c6NP_001102007.1 TFIIIC_sub6 53..86 CDD:287402 12/32 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353984
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AAV2
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008230
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107369
Panther 1 1.100 - - LDO PTHR21860
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.