DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42516 and gtf3c6

DIOPT Version :9

Sequence 1:NP_001163086.1 Gene:CG42516 / 8674068 FlyBaseID:FBgn0260390 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_002937363.1 Gene:gtf3c6 / 100188923 XenbaseID:XB-GENE-5805128 Length:282 Species:Xenopus tropicalis


Alignment Length:154 Identity:35/154 - (22%)
Similarity:64/154 - (41%) Gaps:36/154 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DSSDSEYEDTEYLVFADFKNHIHPHQLKHEDAAIKIIGIESDTPMAEVNGSIYRGRYEHSVGTNV 67
            |..|.|.||  .||..:....|....||..|...||:||.::.|..:|:..::.|.||.::||.|
 Frog    18 DDDDEEEED--QLVMVELTGIIDSDILKKCDKKCKILGINTEKPFLQVDKYVFAGEYEDALGTCV 80

  Fly    68 FFEKEKDNLASDPLFESVCRQRYQYVDKSTKVISFERVY------------VDNLH--------- 111
            .||::.:::..|..     :.:.:|...:.|.::..|.:            ::..|         
 Frog    81 IFEEDPNHIDEDHK-----KPQLKYKCHTVKKLNMTRTFLTEKKEGDAGGKIEWFHIKDVGSSSL 140

  Fly   112 --------QEVEKSAETEEDDQTE 127
                    ||.|...:::.|::.|
 Frog   141 PTTMCSFAQENEDGGDSQSDEEQE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42516NP_001163086.1 TFIIIC_sub6 36..69 CDD:287402 12/32 (38%)
gtf3c6XP_002937363.1 TFIIIC_sub6 32..116 CDD:371039 22/88 (25%)
2A1904 <152..>272 CDD:273344 3/13 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11969
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008230
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21860
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.