DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLa and Otop3

DIOPT Version :9

Sequence 1:NP_001162676.1 Gene:OtopLa / 8674066 FlyBaseID:FBgn0259994 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_081408.2 Gene:Otop3 / 69602 MGIID:1916852 Length:596 Species:Mus musculus


Alignment Length:375 Identity:99/375 - (26%)
Similarity:149/375 - (39%) Gaps:112/375 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   675 PAALSSNIGT-----LNSTACGRIDIMGTIVYDSAPYLYPFIIEYSLIGAVVLYVMWK------- 727
            |..||.| ||     ||:|.| .:...|.::      ||||..||.||...||:||||       
Mouse   264 PYLLSGN-GTNTCMCLNTTVC-EVFRKGYLM------LYPFSTEYCLICCAVLFVMWKNVSRSLA 320

  Fly   728 -HIGRYPGRMNDEDLEHRLEVMLSRRAVAMAQQARSGRVDCVGSSKGLFFGLLLLVGALICLILF 791
             |.|.:|.|.     ..||.                      |:..|...|||.|| |.:|:.:.
Mouse   321 AHTGAHPNRS-----PFRLH----------------------GTIFGPLLGLLALV-AGVCVFVL 357

  Fly   792 FVL------VRHQQFSL-LAIYLADASHCIL--MAFAILA-IIVGFIRVKNLKFRCEEQSNLNDI 846
            |.:      :..|.|:| .|.|:|     :|  |:.|.|| ..:..:..:.|........:|:.:
Mouse   358 FQIEASGPDIARQYFTLYYAFYVA-----VLPTMSLACLAGTAIHGLEERELDTLKNPTRSLDVV 417

  Fly   847 LLRISAFGLFTYSVFSIIAGSLKVLESEP----SLLVTTTGGVAVFQVILQLLFIADVSRRR--- 904
            ||..:|.|....:.|||:|    ::.::|    :.|:.....:.:.|.|.|.|||.:...||   
Mouse   418 LLMGAALGQMGIAYFSIVA----IVATQPHELLNQLILAYSLLLILQHITQNLFIIEGLHRRPLW 478

  Fly   905 ------------VHLPE--------HDRSKPGR-----------------QIVTFLLICNVAMFA 932
                        |.||.        .|..:..|                 :|..||::||:.::.
Mouse   479 EPAVSGVMEKQDVELPRRGSLRELGQDLRRASRAYIHSFSHLNWKRRMLKEISLFLILCNITLWM 543

  Fly   933 IYTFEAQKVFANPVQLEFYGFVPWSIIQRITLPLCIFHRFHSAVTLAEIW 982
            :..|.....|.|.::.:|||:..|..|....|||.:|:|.||...|.|::
Mouse   544 MPAFGIHPEFENGLEKDFYGYRTWFTIVNFGLPLGVFYRMHSVGGLVEVY 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OtopLaNP_001162676.1 Otopetrin 278..>405 CDD:281218
Otopetrin <679..972 CDD:281218 92/359 (26%)
Otop3NP_081408.2 Otopetrin 143..582 CDD:281218 94/362 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4740
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4117
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243107at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8758
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21522
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X278
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.930

Return to query results.
Submit another query.