DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLa and OTOP3

DIOPT Version :9

Sequence 1:NP_001162676.1 Gene:OtopLa / 8674066 FlyBaseID:FBgn0259994 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_839947.1 Gene:OTOP3 / 347741 HGNCID:19658 Length:596 Species:Homo sapiens


Alignment Length:351 Identity:89/351 - (25%)
Similarity:142/351 - (40%) Gaps:88/351 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   685 LNSTACGRIDIMGTIVYDSAPYLYPFIIEYSLIGAVVLYVMWKHIGRYPGRMNDEDLEHRLEVML 749
            ||:|||.... .|.::      ||||..||.||...||:||||::||:.                
Human   278 LNATACEAFR-RGFLM------LYPFSTEYCLICCAVLFVMWKNVGRHV---------------- 319

  Fly   750 SRRAVAMAQQARSGRVDCVGSSKGLFFGLLLLVGALICLILFFV-----LVRHQQFSL-LAIYLA 808
               |..|.....:......|:..|...|||:|:..:...:||.:     .:..|.|:| .|.|:|
Human   320 ---APHMGAHPATAPFHLHGAIFGPLLGLLVLLAGVCVFVLFQIEASGPAIACQYFTLYYAFYVA 381

  Fly   809 DASHCIL--MAFAILA-IIVGFIRVKNLKFRCEEQSNLNDILLRISAFGLFTYSVFSIIAGSLKV 870
                 :|  |:.|.|| ..:..:..:.|........:|:.:||..:|.|....:.|||:|    :
Human   382 -----VLPTMSLACLAGTAIHGLEERELDTVKNPTRSLDVVLLMGAALGQMGIAYFSIVA----I 437

  Fly   871 LESEP----SLLVTTTGGVAVFQVILQLLFIADVSRRR---VHLPE----HDRSKPGR------- 917
            :...|    :.|:.....:.:.|.|.|.|||.:...||   ..:||    ...::|.|       
Human   438 VAKRPHELLNRLILAYSLLLILQHIAQNLFIIEGLHRRPLWETVPEGLAGKQEAEPPRRGSLLEL 502

  Fly   918 --------------------------QIVTFLLICNVAMFAIYTFEAQKVFANPVQLEFYGFVPW 956
                                      :|..||::||:.::.:..|.....|.|.::.:|||:..|
Human   503 GQGLQRASLAYIHSYSHLNWKRRALKEISLFLILCNITLWMMPAFGIHPEFENGLEKDFYGYQIW 567

  Fly   957 SIIQRITLPLCIFHRFHSAVTLAEIW 982
            ..|....|||.:|:|.||...|.|::
Human   568 FAIVNFGLPLGVFYRMHSVGGLVEVY 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OtopLaNP_001162676.1 Otopetrin 278..>405 CDD:281218
Otopetrin <679..972 CDD:281218 84/339 (25%)
OTOP3NP_839947.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
Otopetrin 162..582 CDD:281218 84/338 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4740
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I4547
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243107at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8528
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21522
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X278
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.