DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLa and Otop3

DIOPT Version :9

Sequence 1:NP_001162676.1 Gene:OtopLa / 8674066 FlyBaseID:FBgn0259994 Length:991 Species:Drosophila melanogaster
Sequence 2:XP_038941598.1 Gene:Otop3 / 287821 RGDID:1306663 Length:578 Species:Rattus norvegicus


Alignment Length:360 Identity:92/360 - (25%)
Similarity:145/360 - (40%) Gaps:106/360 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   685 LNSTACGRIDIMGTIVYDSAPYLYPFIIEYSLIGAVVLYVMWKHIGR--------YPGRMNDEDL 741
            ||:|.| .:...|.::      ||||..||.||...||:||||::||        :|.|.     
  Rat   260 LNATVC-EVFRKGFLM------LYPFSTEYCLICCAVLFVMWKNVGRSLAAHSGAHPNRP----- 312

  Fly   742 EHRLEVMLSRRAVAMAQQARSGRVDCVGSSKGLFFGLLLLVGALICLILFFVL------VRHQQF 800
            ..||.                      |:..|...|||.|| |.:|:.:.|.:      :..|.|
  Rat   313 PFRLH----------------------GAIFGPLLGLLALV-AGVCVFVLFQIEASGPDIARQYF 354

  Fly   801 SL-LAIYLADASHCIL--MAFAILA-IIVGFIRVKNLKFRCEEQSNLNDILLRISAFGLFTYSVF 861
            :| .|.|:|     :|  |:.|.|| ..:..:..:.|........:|:.:||..:|.|....:.|
  Rat   355 TLYYAFYVA-----VLPTMSLACLAGTAIHGLEERELDTLKNPTRSLDVVLLMGAALGQMGIAYF 414

  Fly   862 SIIAGSLKVLESEP----SLLVTTTGGVAVFQVILQLLFIADVSRRR---------------VHL 907
            ||:|    ::.::|    :.|:.....:.:.|.|.|.|||.:...||               :.|
  Rat   415 SIVA----IVATQPHQLLNQLILAYSLLLILQHITQNLFIIEGLHRRPLWEPVISGVPEKQDIEL 475

  Fly   908 PE--------HDRSKPGR-----------------QIVTFLLICNVAMFAIYTFEAQKVFANPVQ 947
            |.        .|..:..|                 :|..||::||:.::.:..|.....|.|.::
  Rat   476 PRRGSLRELGQDLRRASRAYIHSFSHLNWKRRMLKEISLFLILCNITLWMMPAFGIHPEFENGLE 540

  Fly   948 LEFYGFVPWSIIQRITLPLCIFHRFHSAVTLAEIW 982
            .:|||:..|..|....|||.:|:|.||...|.|::
  Rat   541 KDFYGYRTWFTIVNFGLPLGVFYRMHSVGGLVEVY 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OtopLaNP_001162676.1 Otopetrin 278..>405 CDD:281218
Otopetrin <679..972 CDD:281218 87/348 (25%)
Otop3XP_038941598.1 Otopetrin 149..564 CDD:397346 87/347 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4035
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243107at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21522
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X278
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.