DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLa and R10F2.6

DIOPT Version :10

Sequence 1:NP_001162676.1 Gene:OtopLa / 8674066 FlyBaseID:FBgn0259994 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_497642.2 Gene:R10F2.6 / 175405 WormBaseID:WBGene00019997 Length:1161 Species:Caenorhabditis elegans


Alignment Length:106 Identity:25/106 - (23%)
Similarity:37/106 - (34%) Gaps:28/106 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HEMRERLLDQPRETLQLENMERANLLDNRQSASESNQLQGDGYHTSPAHQRTPLVPHDLGEDFNL 72
            |||||              :.:.:.|....:|||....:...:...|..::    |..||     
 Worm  1035 HEMRE--------------LRKTDRLHQAMTASEERDERSPYFDGKPIRRK----PLRLG----- 1076

  Fly    73 DFDDDFPIDARRPKNAKV-CYTFKPNPNKYSFMPAKITVQG 112
                |.|.|.:|||...| ...|.|....||.:..:..:.|
 Worm  1077 ----DKPRDPKRPKRQYVKREDFLPEHELYSALEMEPMISG 1113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OtopLaNP_001162676.1 Otopetrin 278..>425 CDD:460840
Otopetrin <673..972 CDD:460840
R10F2.6NP_497642.2 Y_phosphatase 722..963 CDD:459674
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.