DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLa and R10F2.6

DIOPT Version :9

Sequence 1:NP_001162676.1 Gene:OtopLa / 8674066 FlyBaseID:FBgn0259994 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_497642.2 Gene:R10F2.6 / 175405 WormBaseID:WBGene00019997 Length:1161 Species:Caenorhabditis elegans


Alignment Length:106 Identity:25/106 - (23%)
Similarity:37/106 - (34%) Gaps:28/106 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HEMRERLLDQPRETLQLENMERANLLDNRQSASESNQLQGDGYHTSPAHQRTPLVPHDLGEDFNL 72
            |||||              :.:.:.|....:|||....:...:...|..::    |..||     
 Worm  1035 HEMRE--------------LRKTDRLHQAMTASEERDERSPYFDGKPIRRK----PLRLG----- 1076

  Fly    73 DFDDDFPIDARRPKNAKV-CYTFKPNPNKYSFMPAKITVQG 112
                |.|.|.:|||...| ...|.|....||.:..:..:.|
 Worm  1077 ----DKPRDPKRPKRQYVKREDFLPEHELYSALEMEPMISG 1113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OtopLaNP_001162676.1 Otopetrin 278..>405 CDD:281218
Otopetrin <679..972 CDD:281218
R10F2.6NP_497642.2 Y_phosphatase 722..963 CDD:365874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4740
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.