DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLa and otop2

DIOPT Version :9

Sequence 1:NP_001162676.1 Gene:OtopLa / 8674066 FlyBaseID:FBgn0259994 Length:991 Species:Drosophila melanogaster
Sequence 2:XP_017944835.2 Gene:otop2 / 100496174 XenbaseID:XB-GENE-6045877 Length:588 Species:Xenopus tropicalis


Alignment Length:356 Identity:83/356 - (23%)
Similarity:134/356 - (37%) Gaps:113/356 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   706 YLYPFIIEYSLIGAVVLYVMWKHIGRYPGRMNDEDLEHRLEVMLSRRAVAMAQQARSGRVDCVGS 770
            |||||.|||||..:.:.|||||::||.  .......:|:.:                        
 Frog   270 YLYPFNIEYSLFASAMSYVMWKNVGRV--MSGHHHTQHKFK------------------------ 308

  Fly   771 SKGLFFGLLLLVGALICLILFFVL---------VRHQQFSLLAIYLADASHCILMAFAILA--II 824
            ::.||.||:..:|..:..:..|::         .|.|..::  .|:.:.:...||:...||  ||
 Frog   309 TRNLFVGLICGIGVFVAGLGVFIVYKIEVDVEETRSQAITM--FYIFNITALSLMSVVSLAGTII 371

  Fly   825 VGFIRVKNLKFRCEEQSNLNDILLRISAFGLFTYSVFSIIA-------GSLKVLESEPSLLVTTT 882
            ..|.: :::.........|:.:||..:|.|.:..|.|||:|       |.|..|....:||:   
 Frog   372 YRFYK-RDMDNHKNPTRTLDVVLLLGAALGQYCISFFSIVAMVALQPGGQLHTLILVNALLL--- 432

  Fly   883 GGVAVFQVILQLLFIADVSRRRVHLPEHD------------------------------------ 911
                :.|..:|..||.:...|:.|...|.                                    
 Frog   433 ----IVQHTIQNTFIIEGLHRQPHANSHPAADLQEKDQPPHVYINPAATVSHSDHSPSSHEKHEH 493

  Fly   912 ----------------------RSKPGRQIVTFLLICNVAMFAIYTFEAQKVFANPVQLEFYGFV 954
                                  |.|..::|..|||:.|:..:.:..|.|:..|.|.::|.|||:.
 Frog   494 ELETKHHGTPTGFPECHSKSDWRRKALKEISLFLLVSNIIFWIMPAFGARPQFDNRLELNFYGYT 558

  Fly   955 PWSIIQRITLPLCIFHRFHSAVTLAEIWKTT 985
             |..|..|.||..||:|.|:..:|.|::..|
 Frog   559 -WVAIVNIGLPFGIFYRMHAIASLVEVYIMT 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OtopLaNP_001162676.1 Otopetrin 278..>405 CDD:281218
Otopetrin <679..972 CDD:281218 78/341 (23%)
otop2XP_017944835.2 Otopetrin 134..574 CDD:397346 78/340 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 169 1.000 Inparanoid score I4017
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243107at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9424
Panther 1 1.100 - - O PTHR21522
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X278
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.