DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp35C and Kaz-m1

DIOPT Version :10

Sequence 1:NP_001162982.1 Gene:Sfp35C / 8674064 FlyBaseID:FBgn0259965 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_524507.1 Gene:Kaz-m1 / 43154 FlyBaseID:FBgn0002578 Length:156 Species:Drosophila melanogaster


Alignment Length:73 Identity:20/73 - (27%)
Similarity:33/73 - (45%) Gaps:8/73 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LACM-LIGIAWGEN-------CNKPCGKCILPTCNYDGKCYFEGTSACALENEKCRRKKNNLDQF 65
            |.|: |:...:|..       |...|.....|.|..||:.:.|..|.|.|.:..|||::|::..:
  Fly     8 LCCLALVACVYGNTVSTNDTACPTFCPSIYKPVCGTDGQNFKEFASTCNLLSHNCRRERNSVQAY 72

  Fly    66 VKTVSGFC 73
            ..|.:.:|
  Fly    73 AATDAAWC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp35CNP_001162982.1 None
Kaz-m1NP_524507.1 KAZAL 29..>67 CDD:197624 13/37 (35%)

Return to query results.
Submit another query.