DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp24C1 and CG42460

DIOPT Version :10

Sequence 1:NP_001162865.1 Gene:Sfp24C1 / 8674059 FlyBaseID:FBgn0259956 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_001162857.1 Gene:CG42460 / 8674116 FlyBaseID:FBgn0259950 Length:79 Species:Drosophila melanogaster


Alignment Length:75 Identity:26/75 - (34%)
Similarity:38/75 - (50%) Gaps:9/75 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FCILALLITLKFEMGYGNSVCNLQATFIGWCKMTIRGFTFVASKNACR--RISGPCAAQDNFFMD 66
            |.||..:..||      |.||.::...:|.|||.|....::.::|.|:  .||| |:|:..||..
  Fly    11 FSILGCVSALK------NPVCGVKYRGVGLCKMLITKIVYIPTENKCKTVHISG-CSAEGTFFKS 68

  Fly    67 KASCETACKK 76
            ...||..||:
  Fly    69 IKECEAKCKE 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp24C1NP_001162865.1 None
CG42460NP_001162857.1 Kunitz-type 32..76 CDD:444694 16/44 (36%)

Return to query results.
Submit another query.