DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfp23F and CG13748

DIOPT Version :10

Sequence 1:NP_001162856.1 Gene:Sfp23F / 8674054 FlyBaseID:FBgn0259949 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster


Alignment Length:46 Identity:15/46 - (32%)
Similarity:21/46 - (45%) Gaps:0/46 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QGACNTLITRIGYLRWENMCTSKNFVACDTDGTSFESIKECEDKCK 77
            :|.|..||.|..|...:..|....|..||.:..:|.|.|:|...|:
  Fly    66 KGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfp23FNP_001162856.1 Kunitz-type 32..78 CDD:444694 15/46 (33%)
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 15/46 (33%)

Return to query results.
Submit another query.