DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and LAGE3

DIOPT Version :9

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_006005.2 Gene:LAGE3 / 8270 HGNCID:26058 Length:143 Species:Homo sapiens


Alignment Length:80 Identity:28/80 - (35%)
Similarity:47/80 - (58%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KPNESIIRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSF 72
            :|:...:.|||.||..||||:..|..|.||.:..|.|.|::...:|||.::::..:.||.::.:|
Human    59 RPHIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINF 123

  Fly    73 FECLLLCQDTINQFG 87
            .:.|.|...|:.:||
Human   124 LDQLSLVVRTMQRFG 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 25/69 (36%)
LAGE3NP_006005.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57
Pcc1 63..135 CDD:401328 25/71 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156594
Domainoid 1 1.000 47 1.000 Domainoid score I12039
eggNOG 1 0.900 - - E1_2CZV3
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5441
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005842
OrthoInspector 1 1.000 - - oto90607
orthoMCL 1 0.900 - - OOG6_104774
Panther 1 1.100 - - LDO PTHR31283
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7158
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.