DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcs6 and Ctag2

DIOPT Version :10

Sequence 1:NP_001163743.1 Gene:Tcs6 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_081578.1 Gene:Ctag2 / 70062 MGIID:1917312 Length:219 Species:Mus musculus


Alignment Length:68 Identity:18/68 - (26%)
Similarity:36/68 - (52%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ESIIRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFFEC 75
            |..:.|||.|...|.||.:.|..:.:.::..|::..::.:.:|.|.:.::.....||:|.:|.:.
Mouse   130 EFSVTVPFRTAVEANIACRTLASNIQQQQVMVQQEFTVNDTILTVRWTTEDPVLFRTSINAFLDQ 194

  Fly    76 LLL 78
            |.|
Mouse   195 LSL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcs6NP_001163743.1 Pcc1 14..84 CDD:462764 17/65 (26%)
Ctag2NP_081578.1 Pcc1 130..202 CDD:462764 18/68 (26%)

Return to query results.
Submit another query.